General Information

  • ID:  hor000847
  • Uniprot ID:  Q9U4J0(22-39)
  • Protein name:  Ecdysis triggering hormone 1
  • Gene name:  ETH
  • Organism:  Drosophila melanogaster (Fruit fly)
  • Family:  NA
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  melanogaster subgroup, melanogaster group, Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005102 signaling receptor binding; GO:0005184 neuropeptide hormone activity; GO:0008255 ecdysis-triggering hormone activity
  • GO BP:  GO:0007186 G protein-coupled receptor signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0018990 ecdysis, chitin-based cuticle
  • GO CC:  GO:0005615 extracellular space

Sequence Information

  • Sequence:  DDSSPGFFLKITKNVPRL
  • Length:  18(22-39)
  • Propeptide:  MRIITVLSVSLLVGLVAISQADDSSPGFFLKITKNVPRLGKRGENFAIKNLKTIPRIGRSEHSSVTPLLAWLWDLDTSPSKRRLPAGESPAKEQELNVVQPVNSNTLLELLDNNAIPSEQVKFVHWKDFDRALQADADLYSKVIQLGRRPDQHLKQTLSFGSFVPIFGDEQNPDFMMYKNNEDQELYGGGNRYDRQFLKYNIL
  • Signal peptide:  MRIITVLSVSLLVGLVAISQA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: 3*10(-7)M
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9U4J0-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000847_AF2.pdbhor000847_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 233774 Formula: C93H148N24O27
Absent amino acids: ACEHMQWY Common amino acids: DFKLPS
pI: 9.53 Basic residues: 3
Polar residues: 5 Hydrophobic residues: 6
Hydrophobicity: -37.78 Boman Index: -3377
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 81.11
Instability Index: 5233.33 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  16441518
  • Title:  Direct Mass Spectrometric Peptide Profiling and Fragmentation of Larval Peptide Hormone Release Sites in Drosophila Melanogaster Reveals Tagma-Specific Peptide Expression and Differential Processing